Anti-RMI2
Catalog Number:
ATA-HPA040995
- Images (8)
| Article Name: | Anti-RMI2 |
| Biozol Catalog Number: | ATA-HPA040995 |
| Supplier Catalog Number: | HPA040995 |
| Alternative Catalog Number: | ATA-HPA040995-100,ATA-HPA040995-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BLAP18, C16orf75, MGC24665 |
| RecQ mediated genome instability 2 |
| Anti-RMI2 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 116028 |
| UniProt: | Q96E14 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | GKYVMVMGVVQACSPEPCLQAVKMTDLSDNPIHESMWELEVEDLHRNI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RMI2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nuclear speckles & cytosol. |
|
|
Immunohistochemical staining of human stomach, lower shows strong cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis in human cell lines MCF-7 and U-251MG using Anti-RMI2 antibody. Corresponding RMI2 RNA-seq data are presented for the same cell lines. Loading control: Anti-GAPDH. |
|
|
HPA040995-100ul |
|
|
|
|
|
|
|
|
HPA040995-100ul |
|
|
HPA040995-100ul |
Product Guarantee and Expert Support
