Anti-CHORDC1
Artikelnummer:
ATA-HPA041040
- Bilder (8)
| Artikelname: | Anti-CHORDC1 |
| Artikelnummer: | ATA-HPA041040 |
| Hersteller Artikelnummer: | HPA041040 |
| Alternativnummer: | ATA-HPA041040-100,ATA-HPA041040-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CHP1 |
| cysteine and histidine-rich domain (CHORD) containing 1 |
| Anti-CHORDC1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 26973 |
| UniProt: | Q9UHD1 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CHORDC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to cytosol. |
|
|
Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells. |
|
|
Western blot analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-CHORDC1 antibody. Corresponding CHORDC1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA041040-100ul |
|
|
HPA041040-100ul |
|
|
HPA041040-100ul |
Produktgarantie und fachkundiger Support
