Anti-CHORDC1
Catalog Number:
ATA-HPA041040
- Images (8)
| Article Name: | Anti-CHORDC1 |
| Biozol Catalog Number: | ATA-HPA041040 |
| Supplier Catalog Number: | HPA041040 |
| Alternative Catalog Number: | ATA-HPA041040-100,ATA-HPA041040-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human, Mouse, Rat |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CHP1 |
| cysteine and histidine-rich domain (CHORD) containing 1 |
| Anti-CHORDC1 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 26973 |
| UniProt: | Q9UHD1 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LKGWSCCKRRTTDFSDFLSIVGCTKGRHNSEKPPEPVKPEVKTTEKKELCELKPKFQEHIIQAPKPVEAI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | CHORDC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to cytosol. |
|
|
Immunohistochemical staining of human stomach, upper shows moderate cytoplasmic and nuclear positivity in glandular cells. |
|
|
Western blot analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-CHORDC1 antibody. Corresponding CHORDC1 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp |
|
|
Western blot analysis in mouse cell line NIH-3T3 and rat cell line NBT-II. |
|
|
HPA041040-100ul |
|
|
HPA041040-100ul |
|
|
HPA041040-100ul |
Product Guarantee and Expert Support
