Anti-PGRMC2
Artikelnummer:
ATA-HPA041172
- Bilder (7)
| Artikelname: | Anti-PGRMC2 |
| Artikelnummer: | ATA-HPA041172 |
| Hersteller Artikelnummer: | HPA041172 |
| Alternativnummer: | ATA-HPA041172-100,ATA-HPA041172-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DG6, PMBP |
| progesterone receptor membrane component 2 |
| Anti-PGRMC2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10424 |
| UniProt: | O15173 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | RWRAVMAAGDGDVKLGTLGSGSESSNDGGSESPCDA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PGRMC2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line HeLa shows localization to nuclear bodies, nuclear membrane & cytosol. |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes . |
|
|
Western blot analysis using Anti-PGRMC2 antibody HPA041172 (A) shows similar pattern to independent antibody HPA058652 (B). |
|
|
Western blot analysis in human cell line A-431. |
|
|
HPA041172-100ul |
|
|
HPA041172-100ul |
|
|
HPA041172-100ul |
Produktgarantie und fachkundiger Support
