Anti-PGRMC2
Catalog Number:
ATA-HPA041172
- Images (7)
| Article Name: | Anti-PGRMC2 |
| Biozol Catalog Number: | ATA-HPA041172 |
| Supplier Catalog Number: | HPA041172 |
| Alternative Catalog Number: | ATA-HPA041172-100,ATA-HPA041172-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DG6, PMBP |
| progesterone receptor membrane component 2 |
| Anti-PGRMC2 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 10424 |
| UniProt: | O15173 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | RWRAVMAAGDGDVKLGTLGSGSESSNDGGSESPCDA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PGRMC2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line HeLa shows localization to nuclear bodies, nuclear membrane & cytosol. |
|
|
Immunohistochemical staining of human liver shows strong cytoplasmic positivity in hepatocytes . |
|
|
Western blot analysis using Anti-PGRMC2 antibody HPA041172 (A) shows similar pattern to independent antibody HPA058652 (B). |
|
|
Western blot analysis in human cell line A-431. |
|
|
HPA041172-100ul |
|
|
HPA041172-100ul |
|
|
HPA041172-100ul |
Product Guarantee and Expert Support
