Anti-RILPL1
Artikelnummer:
ATA-HPA041314
- Bilder (9)
| Artikelname: | Anti-RILPL1 |
| Artikelnummer: | ATA-HPA041314 |
| Hersteller Artikelnummer: | HPA041314 |
| Alternativnummer: | ATA-HPA041314-100,ATA-HPA041314-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ39378 |
| Rab interacting lysosomal protein-like 1 |
| Anti-RILPL1 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 353116 |
| UniProt: | Q5EBL4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | RILPL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells and weak membranous staining of glandular cells. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells. |
|
|
HPA041314-100ul |
|
|
|
|
|
HPA041314-100ul |
|
|
HPA041314-100ul |
Produktgarantie und fachkundiger Support
