Anti-RILPL1
Catalog Number:
ATA-HPA041314
- Images (9)
| Article Name: | Anti-RILPL1 |
| Biozol Catalog Number: | ATA-HPA041314 |
| Supplier Catalog Number: | HPA041314 |
| Alternative Catalog Number: | ATA-HPA041314-100,ATA-HPA041314-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ39378 |
| Rab interacting lysosomal protein-like 1 |
| Anti-RILPL1 |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 353116 |
| UniProt: | Q5EBL4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LELDRLRLERMDRIEKERKHQKELELVEDVWRGEAQDLLSQIAQLQEENKQLMTNLSHKDVNFSEEEFQKHEGMSERERQVMKKLKEV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | RILPL1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:500 - 1:1000 |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & cytosol. |
|
|
Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes. |
|
|
Immunohistochemical staining of human skin shows weak cytoplasmic positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells and weak membranous staining of glandular cells. |
|
|
Immunohistochemical staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells. |
|
|
HPA041314-100ul |
|
|
|
|
|
HPA041314-100ul |
|
|
HPA041314-100ul |
Product Guarantee and Expert Support
