Anti-PTCD3
Artikelnummer:
ATA-HPA041382
- Bilder (9)
| Artikelname: | Anti-PTCD3 |
| Artikelnummer: | ATA-HPA041382 |
| Hersteller Artikelnummer: | HPA041382 |
| Alternativnummer: | ATA-HPA041382-100,ATA-HPA041382-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DKFZp666K071, FLJ20758 |
| pentatricopeptide repeat domain 3 |
| Anti-PTCD3 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 55037 |
| UniProt: | Q96EY7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | DQEPSTDYHFQQTGQSEALEEENDETSRRKAGHQFGVTWRAKNNAERIFSLMPEKNEHSYCTMIRGMVKHRAYEQALNLYTELLNNRLHA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PTCD3 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria. |
|
|
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells. |
|
|
Western blot analysis using Anti-PTCD3 antibody HPA041382 (A) shows similar pattern to independent antibody HPA041154 (B). |
|
|
Western blot analysis in human cell line CACO-2. |
|
|
HPA041382-100ul |
|
|
|
|
|
|
|
|
HPA041382-100ul |
|
|
HPA041382-100ul |
Produktgarantie und fachkundiger Support
