Anti-PTCD3

Catalog Number: ATA-HPA041382
Article Name: Anti-PTCD3
Biozol Catalog Number: ATA-HPA041382
Supplier Catalog Number: HPA041382
Alternative Catalog Number: ATA-HPA041382-100,ATA-HPA041382-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: ICC, IHC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: DKFZp666K071, FLJ20758
pentatricopeptide repeat domain 3
Anti-PTCD3
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 55037
UniProt: Q96EY7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: DQEPSTDYHFQQTGQSEALEEENDETSRRKAGHQFGVTWRAKNNAERIFSLMPEKNEHSYCTMIRGMVKHRAYEQALNLYTELLNNRLHA
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: PTCD3
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemical staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.
Western blot analysis using Anti-PTCD3 antibody HPA041382 (A) shows similar pattern to independent antibody HPA041154 (B).
Western blot analysis in human cell line CACO-2.
HPA041382-100ul
HPA041382-100ul
HPA041382-100ul