Anti-IDH3A
Artikelnummer:
ATA-HPA041465
- Bilder (9)
| Artikelname: | Anti-IDH3A |
| Artikelnummer: | ATA-HPA041465 |
| Hersteller Artikelnummer: | HPA041465 |
| Alternativnummer: | ATA-HPA041465-100,ATA-HPA041465-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ICC, IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | IDH3A |
| isocitrate dehydrogenase 3 (NAD+) alpha |
| Anti-IDH3A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 3419 |
| UniProt: | P50213 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | PTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRV |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | IDH3A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria. |
|
|
Immunohistochemical staining of human rectum shows strong granular cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis using Anti-IDH3A antibody HPA041465 (A) shows similar pattern to independent antibody HPA062971 (B). |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA041465-100ul |
|
|
|
|
|
|
|
|
HPA041465-100ul |
|
|
HPA041465-100ul |
Produktgarantie und fachkundiger Support
