Anti-IDH3A
Catalog Number:
ATA-HPA041465
- Images (9)
| Article Name: | Anti-IDH3A |
| Biozol Catalog Number: | ATA-HPA041465 |
| Supplier Catalog Number: | HPA041465 |
| Alternative Catalog Number: | ATA-HPA041465-100,ATA-HPA041465-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ICC, IHC, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | IDH3A |
| isocitrate dehydrogenase 3 (NAD+) alpha |
| Anti-IDH3A |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 3419 |
| UniProt: | P50213 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | PTALLLSAVMMLRHMGLFDHAARIEAACFATIKDGKSLTKDLGGNAKCSDFTEEICRRV |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | IDH3A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to mitochondria. |
|
|
Immunohistochemical staining of human rectum shows strong granular cytoplasmic positivity in glandular cells. |
|
|
Western blot analysis using Anti-IDH3A antibody HPA041465 (A) shows similar pattern to independent antibody HPA062971 (B). |
|
|
Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells) |
|
|
HPA041465-100ul |
|
|
|
|
|
|
|
|
HPA041465-100ul |
|
|
HPA041465-100ul |
Product Guarantee and Expert Support
