Anti-SQRDL
Artikelnummer:
ATA-HPA041589
- Bilder (8)
| Artikelname: | Anti-SQRDL |
| Artikelnummer: | ATA-HPA041589 |
| Hersteller Artikelnummer: | HPA041589 |
| Alternativnummer: | ATA-HPA041589-100,ATA-HPA041589-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CGI-44 |
| sulfide quinone reductase-like (yeast) |
| Anti-SQRDL |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 58472 |
| UniProt: | Q9Y6N5 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | LIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SQRDL |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human stomach shows strong positivity in a subset of glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human liver shows moderate positivity in cytoplasm granular in hepatocytes. |
|
|
Immunohistochemical staining of human rectum shows moderate granular cytoplasmic positivity in glandular cells. |
|
|
HPA041589-100ul |
|
|
HPA041589-100ul |
|
|
HPA041589-100ul |
Produktgarantie und fachkundiger Support
