Anti-SQRDL
Catalog Number:
ATA-HPA041589
- Images (8)
| Article Name: | Anti-SQRDL |
| Biozol Catalog Number: | ATA-HPA041589 |
| Supplier Catalog Number: | HPA041589 |
| Alternative Catalog Number: | ATA-HPA041589-100,ATA-HPA041589-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CGI-44 |
| sulfide quinone reductase-like (yeast) |
| Anti-SQRDL |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 58472 |
| UniProt: | Q9Y6N5 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | LIIALGIQLDYEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKANIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SQRDL |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human prostate shows moderate granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human stomach shows strong positivity in a subset of glandular cells. |
|
|
Immunohistochemical staining of human kidney shows moderate granular cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human liver shows moderate positivity in cytoplasm granular in hepatocytes. |
|
|
Immunohistochemical staining of human rectum shows moderate granular cytoplasmic positivity in glandular cells. |
|
|
HPA041589-100ul |
|
|
HPA041589-100ul |
|
|
HPA041589-100ul |
Product Guarantee and Expert Support
