Anti-DGKA
Artikelnummer:
ATA-HPA041645
- Bilder (8)
| Artikelname: | Anti-DGKA |
| Artikelnummer: | ATA-HPA041645 |
| Hersteller Artikelnummer: | HPA041645 |
| Alternativnummer: | ATA-HPA041645-100,ATA-HPA041645-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DAGK, DAGK1, DGK-alpha |
| diacylglycerol kinase, alpha 80kDa |
| Anti-DGKA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 1606 |
| UniProt: | P23743 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | DGKA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human lymph node shows strong membranous positivity in lymphocytes. |
|
|
Immunohistochemical staining of human tonsil shows strong membranous positivity in lymphocytes. |
|
|
Immunohistochemical staining of human small intestine shows strong membranous positivity in lymphocytes. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
HPA041645-100ul |
|
|
HPA041645-100ul |
|
|
HPA041645-100ul |
Produktgarantie und fachkundiger Support
