Anti-DGKA
Catalog Number:
ATA-HPA041645
- Images (8)
| Article Name: | Anti-DGKA |
| Biozol Catalog Number: | ATA-HPA041645 |
| Supplier Catalog Number: | HPA041645 |
| Alternative Catalog Number: | ATA-HPA041645-100,ATA-HPA041645-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | DAGK, DAGK1, DGK-alpha |
| diacylglycerol kinase, alpha 80kDa |
| Anti-DGKA |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 1606 |
| UniProt: | P23743 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | DGKA |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemical staining of human lymph node shows strong membranous positivity in lymphocytes. |
|
|
Immunohistochemical staining of human tonsil shows strong membranous positivity in lymphocytes. |
|
|
Immunohistochemical staining of human small intestine shows strong membranous positivity in lymphocytes. |
|
|
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 |
|
|
HPA041645-100ul |
|
|
HPA041645-100ul |
|
|
HPA041645-100ul |
Product Guarantee and Expert Support
