Anti-APOBR
Artikelnummer:
ATA-HPA041667
- Bilder (9)
| Artikelname: | Anti-APOBR |
| Artikelnummer: | ATA-HPA041667 |
| Hersteller Artikelnummer: | HPA041667 |
| Alternativnummer: | ATA-HPA041667-100,ATA-HPA041667-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | APOB100R, APOB48R |
| apolipoprotein B receptor |
| Anti-APOBR |
| Klonalität: | Polyclonal |
| Konzentration: | 0.4 mg/ml |
| Isotyp: | IgG |
| NCBI: | 55911 |
| UniProt: | Q0VD83 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EKWTLLEEEAVGWQEREQREDSEGRCGDYHPEGEAPRLLDAEGLMVTGGRRAEAKETEPESLEHVRGQEEQPTHQAPAEAAPESVGEA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | APOBR |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human spleen and liver tissues using Anti-APOBR antibody. Corresponding APOBR RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, liver, lymph node and spleen using Anti-APOBR antibody HPA041667 (A) shows similar protein distribution across tissues to independent antibody HPA042093 (B). |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human spleen shows high expression. |
|
|
Immunohistochemical staining of human colon using Anti-APOBR antibody HPA041667. |
|
|
Immunohistochemical staining of human lymph node using Anti-APOBR antibody HPA041667. |
|
|
HPA041667-100ul |
|
|
HPA041667-100ul |
|
|
HPA041667-100ul |
Produktgarantie und fachkundiger Support
