Anti-APOBR
Catalog Number:
ATA-HPA041667
- Images (9)
| Article Name: | Anti-APOBR |
| Biozol Catalog Number: | ATA-HPA041667 |
| Supplier Catalog Number: | HPA041667 |
| Alternative Catalog Number: | ATA-HPA041667-100,ATA-HPA041667-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | APOB100R, APOB48R |
| apolipoprotein B receptor |
| Anti-APOBR |
| Clonality: | Polyclonal |
| Concentration: | 0.4 mg/ml |
| Isotype: | IgG |
| NCBI: | 55911 |
| UniProt: | Q0VD83 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | EKWTLLEEEAVGWQEREQREDSEGRCGDYHPEGEAPRLLDAEGLMVTGGRRAEAKETEPESLEHVRGQEEQPTHQAPAEAAPESVGEA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | APOBR |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemistry analysis in human spleen and liver tissues using Anti-APOBR antibody. Corresponding APOBR RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human colon, liver, lymph node and spleen using Anti-APOBR antibody HPA041667 (A) shows similar protein distribution across tissues to independent antibody HPA042093 (B). |
|
|
Immunohistochemical staining of human liver shows low expression as expected. |
|
|
Immunohistochemical staining of human spleen shows high expression. |
|
|
Immunohistochemical staining of human colon using Anti-APOBR antibody HPA041667. |
|
|
Immunohistochemical staining of human lymph node using Anti-APOBR antibody HPA041667. |
|
|
HPA041667-100ul |
|
|
HPA041667-100ul |
|
|
HPA041667-100ul |
Product Guarantee and Expert Support
