Anti-NOD2

Artikelnummer: ATA-HPA041985
Artikelname: Anti-NOD2
Artikelnummer: ATA-HPA041985
Hersteller Artikelnummer: HPA041985
Alternativnummer: ATA-HPA041985-100,ATA-HPA041985-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: BLAU, CARD15, CD, CLR16.3, IBD1, NLRC2, PSORAS1
nucleotide-binding oligomerization domain containing 2

Anti-NOD2

Klonalität: Polyclonal
Konzentration: 0.1 mg/ml
Isotyp: IgG
NCBI: 64127
UniProt: Q9HC29
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: VWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: NOD2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human skin and kidney tissues using HPA041985 antibody. Corresponding NOD2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells.
Immunohistochemical staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes.
Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected.
Western blot analysis using Anti-NOD2 antibody HPA041985 (A) shows similar pattern to independent antibody HPA054494 (B).
HPA041985-100ul
HPA041985-100ul
HPA041985-100ul