Anti-NOD2
Catalog Number:
ATA-HPA041985
- Images (9)
| Article Name: | Anti-NOD2 |
| Biozol Catalog Number: | ATA-HPA041985 |
| Supplier Catalog Number: | HPA041985 |
| Alternative Catalog Number: | ATA-HPA041985-100,ATA-HPA041985-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BLAU, CARD15, CD, CLR16.3, IBD1, NLRC2, PSORAS1 |
| nucleotide-binding oligomerization domain containing 2 |
Anti-NOD2
|
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 64127 |
| UniProt: | Q9HC29 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | VWNKGTWACQKLIAAAQEAQADSQSPKLHGCWDPHSLHPARDLQSHRPAIVRRLHSHVENMLDLAWERGFVSQYECDEIRLPI |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | NOD2 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human skin and kidney tissues using HPA041985 antibody. Corresponding NOD2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human duodenum shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human skin shows moderate to strong cytoplasmic positivity in keratinocytes. |
|
|
Immunohistochemical staining of human kidney shows no positivity in cells in tubules as expected. |
|
|
Western blot analysis using Anti-NOD2 antibody HPA041985 (A) shows similar pattern to independent antibody HPA054494 (B). |
|
|
HPA041985-100ul |
|
|
HPA041985-100ul |
|
|
HPA041985-100ul |
Product Guarantee and Expert Support
