Anti-TMEM231, Rabbit, Polyclonal

Produktübersicht

• Artikelname: Anti-TMEM231, Rabbit, Polyclonal
• Artikelnummer: ATA-HPA042081
• Hersteller Artikelnummer: HPA042081
• Alternativnummer: ATA-HPA042081-100,ATA-HPA042081-25
• Hersteller: Atlas Antibodies
• Wirt: Rabbit
• Kategorie: Antikörper
• Applikation: IHC, ICC
• Spezies Reaktivität: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Konjugation: Unconjugated
• Alternative Synonym: ALYE870, FLJ22167, JBTS20, MKS11, PRO1886

Produktbeschreibung

transmembrane protein 231

Zusatzinformationen

Anti-TMEM231

Produkteigenschaften

• Klonalität: Polyclonal
• Konzentration: 0.4 mg/ml
• Isotyp: IgG
• NCBI: 79583
• UniProt: Q9H6L2
• Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Reinheit: Affinity purified using the PrEST antigen as affinity ligand
• Sequenz: SQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDLTHIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVI
• Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Anwendungsbeschreibung

• Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Bilder

Immunofluorescent staining of human cell line A-431 shows localization to vesicles.

Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-TMEM231 antibody. Corresponding TMEM231 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human prostate shows low expression as expected.

Immunohistochemical staining of human fallopian tube shows high expression.

Western blot analysis in control (vector only transfected HEK293T lysate) and TMEM231 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY421414).