Anti-TMEM231, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-TMEM231, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA042081
• Supplier Catalog Number: HPA042081
• Alternative Catalog Number: ATA-HPA042081-100,ATA-HPA042081-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC, ICC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: ALYE870, FLJ22167, JBTS20, MKS11, PRO1886

Product Description

transmembrane protein 231

Additional Information

Anti-TMEM231

Product Properties

• Clonality: Polyclonal
• Concentration: 0.4 mg/ml
• Isotype: IgG
• NCBI: 79583
• UniProt: Q9H6L2
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: SQLYVNGDLRLQQKQPLSCGGLDARYNISVINGTSPFAYDYDLTHIVAAYQERNVTTVLNDPNPIWLVGRAADAPFVINAIIRYPVEVI
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunofluorescent staining of human cell line A-431 shows localization to vesicles.

Immunohistochemistry analysis in human fallopian tube and prostate tissues using Anti-TMEM231 antibody. Corresponding TMEM231 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human prostate shows low expression as expected.

Immunohistochemical staining of human fallopian tube shows high expression.

Western blot analysis in control (vector only transfected HEK293T lysate) and TMEM231 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY421414).