Anti-SEMA7A
Artikelnummer:
ATA-HPA042273
- Bilder (8)
| Artikelname: | Anti-SEMA7A |
| Artikelnummer: | ATA-HPA042273 |
| Hersteller Artikelnummer: | HPA042273 |
| Alternativnummer: | ATA-HPA042273-100,ATA-HPA042273-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD108, H-Sema-L, SEMAL |
| semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) |
| Anti-SEMA7A |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 8482 |
| UniProt: | O75326 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | QDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGD |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SEMA7A |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA042273 antibody. Corresponding SEMA7A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong membranous positivity in neurons. |
|
|
Immunohistochemical staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong membranous positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA042273-100ul |
|
|
HPA042273-100ul |
|
|
HPA042273-100ul |
Produktgarantie und fachkundiger Support
