Anti-SEMA7A
Catalog Number:
ATA-HPA042273
- Images (8)
| Article Name: | Anti-SEMA7A |
| Biozol Catalog Number: | ATA-HPA042273 |
| Supplier Catalog Number: | HPA042273 |
| Alternative Catalog Number: | ATA-HPA042273-100,ATA-HPA042273-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | CD108, H-Sema-L, SEMAL |
| semaphorin 7A, GPI membrane anchor (John Milton Hagen blood group) |
| Anti-SEMA7A |
| Clonality: | Polyclonal |
| Concentration: | 0.3 mg/ml |
| Isotype: | IgG |
| NCBI: | 8482 |
| UniProt: | O75326 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | QDRVDFGQTEPHTVLFHEPGSSSVWVGGRGKVYLFDFPEGKNASVRTVNIGSTKGSCLDKRDCENYITLLERRSEGLLACGTNARHPSCWNLVNGTVVPLGEMRGYAPFSPDENSLVLFEGD |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SEMA7A |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemistry analysis in human testis and skeletal muscle tissues using HPA042273 antibody. Corresponding SEMA7A RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows moderate to strong membranous positivity in neurons. |
|
|
Immunohistochemical staining of human placenta shows moderate to strong membranous positivity in trophoblastic cells. |
|
|
Immunohistochemical staining of human testis shows moderate to strong membranous positivity in cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA042273-100ul |
|
|
HPA042273-100ul |
|
|
HPA042273-100ul |
Product Guarantee and Expert Support
