Anti-MGA
Artikelnummer:
ATA-HPA042278
- Bilder (7)
| Artikelname: | Anti-MGA |
| Artikelnummer: | ATA-HPA042278 |
| Hersteller Artikelnummer: | HPA042278 |
| Alternativnummer: | ATA-HPA042278-100,ATA-HPA042278-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ12634, KIAA0518, MAD5, MXD5 |
| MGA, MAX dimerization protein |
| Anti-MGA |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 23269 |
| UniProt: | Q8IWI9 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KLGDVKVEQQKGFDNPEENSSEFPVTFKEESKFELSGSKVMEQQSNLQPEAKEKECGDSLEKDRERWRKHLKGPLTRKCVGASQECKKEADEQLIKETKTCQENSDVFQQEQGISDLLGKSGITEDARVLKTECDSWSRIS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | MGA |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular and stromal cells. |
|
|
Immunohistochemical staining of human uterine cervix shows weak to moderate nuclear positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
HPA042278-100ul |
|
|
HPA042278-100ul |
|
|
HPA042278-100ul |
Produktgarantie und fachkundiger Support
