Anti-MGA
Catalog Number:
ATA-HPA042278
- Images (7)
| Article Name: | Anti-MGA |
| Biozol Catalog Number: | ATA-HPA042278 |
| Supplier Catalog Number: | HPA042278 |
| Alternative Catalog Number: | ATA-HPA042278-100,ATA-HPA042278-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ12634, KIAA0518, MAD5, MXD5 |
| MGA, MAX dimerization protein |
| Anti-MGA |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 23269 |
| UniProt: | Q8IWI9 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KLGDVKVEQQKGFDNPEENSSEFPVTFKEESKFELSGSKVMEQQSNLQPEAKEKECGDSLEKDRERWRKHLKGPLTRKCVGASQECKKEADEQLIKETKTCQENSDVFQQEQGISDLLGKSGITEDARVLKTECDSWSRIS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | MGA |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:1000 - 1:2500 |
|
|
Immunohistochemical staining of human endometrium shows moderate nuclear positivity in glandular and stromal cells. |
|
|
Immunohistochemical staining of human uterine cervix shows weak to moderate nuclear positivity in squamous epithelial cells. |
|
|
Immunohistochemical staining of human testis shows moderate nuclear positivity in a subset of cells in seminiferous ducts. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in striated muscle fibers as expected. |
|
|
HPA042278-100ul |
|
|
HPA042278-100ul |
|
|
HPA042278-100ul |
Product Guarantee and Expert Support
