Anti-WFDC2
Artikelnummer:
ATA-HPA042302
- Bilder (8)
| Artikelname: | Anti-WFDC2 |
| Artikelnummer: | ATA-HPA042302 |
| Hersteller Artikelnummer: | HPA042302 |
| Alternativnummer: | ATA-HPA042302-100,ATA-HPA042302-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | dJ461P17.6, EDDM4, HE4, WAP5 |
| WAP four-disulfide core domain 2 |
| Anti-WFDC2 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 10406 |
| UniProt: | Q14508 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | WFDC2 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line A-431 shows localization to cytosol. |
|
|
Immunohistochemistry analysis in human cervix, uterine and ovary tissues using Anti-WFDC2 antibody. Corresponding WFDC2 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cervix, uterine shows high expression. |
|
|
Immunohistochemical staining of human ovary shows low expression as expected. |
|
|
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line EFO-21 |
|
|
HPA042302-100ul |
|
|
HPA042302-100ul |
|
|
HPA042302-100ul |
Produktgarantie und fachkundiger Support
