Anti-WFDC2

Catalog Number: ATA-HPA042302
Article Name: Anti-WFDC2
Biozol Catalog Number: ATA-HPA042302
Supplier Catalog Number: HPA042302
Alternative Catalog Number: ATA-HPA042302-100,ATA-HPA042302-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: dJ461P17.6, EDDM4, HE4, WAP5
WAP four-disulfide core domain 2
Anti-WFDC2
Clonality: Polyclonal
Concentration: 0.05 mg/ml
Isotype: IgG
NCBI: 10406
UniProt: Q14508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: EKTGVCPELQADQNCTQECVSDSECADNLKCCSAGCATFCSLPNDKEGSCPQVNINFPQLGLCRDQCQVDSQCPGQMKCCRNGCGKVSCVTPNF
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target: WFDC2
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:50 - 1:200, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Immunohistochemistry analysis in human cervix, uterine and ovary tissues using Anti-WFDC2 antibody. Corresponding WFDC2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cervix, uterine shows high expression.
Immunohistochemical staining of human ovary shows low expression as expected.
Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: Human cell line EFO-21
HPA042302-100ul
HPA042302-100ul
HPA042302-100ul