Anti-ADGRD1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA042395
Artikelname: Anti-ADGRD1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA042395
Hersteller Artikelnummer: HPA042395
Alternativnummer: ATA-HPA042395-100,ATA-HPA042395-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: DKFZp434B1272, GPR133, PGR25
adhesion G protein-coupled receptor D1
Anti-ADGRD1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 283383
UniProt: Q6QNK2
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: NSEVRAAFKHKTKVWSLTSSSARTSNAKPFHSDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemical staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells with distinct extracellular material.