Anti-ADGRD1, Rabbit, Polyclonal

Product Overview

• Article Name: Anti-ADGRD1, Rabbit, Polyclonal
• Biozol Catalog Number: ATA-HPA042395
• Supplier Catalog Number: HPA042395
• Alternative Catalog Number: ATA-HPA042395-100,ATA-HPA042395-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: DKFZp434B1272, GPR133, PGR25

Product Description

adhesion G protein-coupled receptor D1

Additional Information

Anti-ADGRD1

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 283383
• UniProt: Q6QNK2
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: NSEVRAAFKHKTKVWSLTSSSARTSNAKPFHSDLMNGTRPGMASTKLSPWDKSSHSAHRVDLSAV
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemical staining of human bronchus shows strong cytoplasmic positivity in respiratory epithelial cells with distinct extracellular material.