Anti-GRWD1, Rabbit, Polyclonal

Artikelnummer: ATA-HPA042643
Artikelname: Anti-GRWD1, Rabbit, Polyclonal
Artikelnummer: ATA-HPA042643
Hersteller Artikelnummer: HPA042643
Alternativnummer: ATA-HPA042643-100,ATA-HPA042643-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC, ICC, WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: GRWD, RRB1, WDR28
glutamate-rich WD repeat containing 1
Anti-GRWD1
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 83743
UniProt: Q9BQ67
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: PVTSVEWHPQDSGVFAASGADHQITQWDLAVERDPEAGDVEADPGLADLPQQLLFVHQGETELKELHWHPQCPGLLVSTALSGFTIFRTISV
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Verdünnung: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & cytosol.
Immunohistochemical staining of human lymph node shows nuclear positivity.
Western blot analysis using Anti-GRWD1 antibody HPA042643 (A) shows similar pattern to independent antibody HPA055680 (B).