Anti-GRWD1, Rabbit, Polyclonal

Catalog Number: ATA-HPA042643
Article Name: Anti-GRWD1, Rabbit, Polyclonal
Biozol Catalog Number: ATA-HPA042643
Supplier Catalog Number: HPA042643
Alternative Catalog Number: ATA-HPA042643-100,ATA-HPA042643-25
Manufacturer: Atlas Antibodies
Host: Rabbit
Category: Antikörper
Application: IHC, ICC, WB
Species Reactivity: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Conjugation: Unconjugated
Alternative Names: GRWD, RRB1, WDR28
glutamate-rich WD repeat containing 1
Anti-GRWD1
Clonality: Polyclonal
Concentration: 0.2 mg/ml
Isotype: IgG
NCBI: 83743
UniProt: Q9BQ67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purity: Affinity purified using the PrEST antigen as affinity ligand
Sequence: PVTSVEWHPQDSGVFAASGADHQITQWDLAVERDPEAGDVEADPGLADLPQQLLFVHQGETELKELHWHPQCPGLLVSTALSGFTIFRTISV
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Antibody Type: Monoclonal Antibody
Application Dilute: ICC-IF: 0.25-2 µg/ml, IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus, nucleoli & cytosol.
Immunohistochemical staining of human lymph node shows nuclear positivity.
Western blot analysis using Anti-GRWD1 antibody HPA042643 (A) shows similar pattern to independent antibody HPA055680 (B).