Anti-SMC6
Artikelnummer:
ATA-HPA042733
- Bilder (7)
| Artikelname: | Anti-SMC6 |
| Artikelnummer: | ATA-HPA042733 |
| Hersteller Artikelnummer: | HPA042733 |
| Alternativnummer: | ATA-HPA042733-100,ATA-HPA042733-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | FLJ22116, SMC6L1 |
| structural maintenance of chromosomes 6 |
| Anti-SMC6 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.1 mg/ml |
| Isotyp: | IgG |
| NCBI: | 79677 |
| UniProt: | Q96SB8 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | KEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCL |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | SMC6 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human prostate shows weak nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected. |
|
|
Immunohistochemical staining of human placenta shows weak nuclear positivity in a subset of trophoblastic cells. |
|
|
Immunohistochemical staining of human testis shows weak nuclear positivity in cells in seminiferous ducts. |
|
|
HPA042733-100ul |
|
|
HPA042733-100ul |
|
|
HPA042733-100ul |
Produktgarantie und fachkundiger Support
