Anti-SMC6
Catalog Number:
ATA-HPA042733
- Images (7)
| Article Name: | Anti-SMC6 |
| Biozol Catalog Number: | ATA-HPA042733 |
| Supplier Catalog Number: | HPA042733 |
| Alternative Catalog Number: | ATA-HPA042733-100,ATA-HPA042733-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | FLJ22116, SMC6L1 |
| structural maintenance of chromosomes 6 |
| Anti-SMC6 |
| Clonality: | Polyclonal |
| Concentration: | 0.1 mg/ml |
| Isotype: | IgG |
| NCBI: | 79677 |
| UniProt: | Q96SB8 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEAIDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCL |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | SMC6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human prostate shows weak nuclear positivity in glandular cells. |
|
|
Immunohistochemical staining of human skeletal muscle shows no nuclear positivity in striated muscle fibers as expected. |
|
|
Immunohistochemical staining of human placenta shows weak nuclear positivity in a subset of trophoblastic cells. |
|
|
Immunohistochemical staining of human testis shows weak nuclear positivity in cells in seminiferous ducts. |
|
|
HPA042733-100ul |
|
|
HPA042733-100ul |
|
|
HPA042733-100ul |
Product Guarantee and Expert Support
