Anti-PRNP
Artikelnummer:
ATA-HPA042754
- Bilder (8)
| Artikelname: | Anti-PRNP |
| Artikelnummer: | ATA-HPA042754 |
| Hersteller Artikelnummer: | HPA042754 |
| Alternativnummer: | ATA-HPA042754-100,ATA-HPA042754-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | AltPrP, CD230, CJD, GSS, PRIP, PRP |
| prion protein |
| Anti-PRNP |
| Klonalität: | Polyclonal |
| Konzentration: | 0.05 mg/ml |
| Isotyp: | IgG |
| NCBI: | 5621 |
| UniProt: | P04156 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | SDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYE |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | PRNP |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA042754 antibody. Corresponding PRNP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human skin shows weak to moderate cytoplasmic positivity in keratinocytes. |
|
|
Immunohistochemical staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA042754-100ul |
|
|
HPA042754-100ul |
|
|
HPA042754-100ul |
Produktgarantie und fachkundiger Support
