Anti-PRNP
Catalog Number:
ATA-HPA042754
- Images (8)
| Article Name: | Anti-PRNP |
| Biozol Catalog Number: | ATA-HPA042754 |
| Supplier Catalog Number: | HPA042754 |
| Alternative Catalog Number: | ATA-HPA042754-100,ATA-HPA042754-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | AltPrP, CD230, CJD, GSS, PRIP, PRP |
| prion protein |
| Anti-PRNP |
| Clonality: | Polyclonal |
| Concentration: | 0.05 mg/ml |
| Isotype: | IgG |
| NCBI: | 5621 |
| UniProt: | P04156 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | SDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYE |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PRNP |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:200 - 1:500 |
|
|
Immunohistochemistry analysis in human cerebral cortex and skeletal muscle tissues using HPA042754 antibody. Corresponding PRNP RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex shows weak to moderate cytoplasmic positivity in neurons. |
|
|
Immunohistochemical staining of human skin shows weak to moderate cytoplasmic positivity in keratinocytes. |
|
|
Immunohistochemical staining of human liver shows weak to moderate cytoplasmic positivity in hepatocytes. |
|
|
Immunohistochemical staining of human skeletal muscle shows no positivity in myocytes as expected. |
|
|
HPA042754-100ul |
|
|
HPA042754-100ul |
|
|
HPA042754-100ul |
Product Guarantee and Expert Support
