Anti-PFDN6

Artikelnummer: ATA-HPA043032
Artikelname: Anti-PFDN6
Artikelnummer: ATA-HPA043032
Hersteller Artikelnummer: HPA043032
Alternativnummer: ATA-HPA043032-100,ATA-HPA043032-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: H2-KE2, HKE2, KE-2, PFD6
prefoldin subunit 6
Anti-PFDN6
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 10471
UniProt: O15212
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: KKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELG
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PFDN6
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:20 - 1:50
Immunohistochemical staining of human colon, liver, pancreas and testis using Anti-PFDN6 antibody HPA043032 (A) shows similar protein distribution across tissues to independent antibody HPA048123 (B).
Immunohistochemical staining of human pancreas using Anti-PFDN6 antibody HPA043032.
Immunohistochemical staining of human colon using Anti-PFDN6 antibody HPA043032.
Immunohistochemical staining of human testis using Anti-PFDN6 antibody HPA043032.
Immunohistochemical staining of human liver using Anti-PFDN6 antibody HPA043032.
HPA043032-100ul
HPA043032-100ul
HPA043032-100ul