Anti-PFDN6
Catalog Number:
ATA-HPA043032
- Images (8)
| Article Name: | Anti-PFDN6 |
| Biozol Catalog Number: | ATA-HPA043032 |
| Supplier Catalog Number: | HPA043032 |
| Alternative Catalog Number: | ATA-HPA043032-100,ATA-HPA043032-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | H2-KE2, HKE2, KE-2, PFD6 |
| prefoldin subunit 6 |
| Anti-PFDN6 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 10471 |
| UniProt: | O15212 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | KKLQGEVEKYQQLQKDLSKSMSGRQKLEAQLTENNIVKEELALLDGSNVVFKLLGPVLVKQELG |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | PFDN6 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:20 - 1:50 |
|
|
Immunohistochemical staining of human colon, liver, pancreas and testis using Anti-PFDN6 antibody HPA043032 (A) shows similar protein distribution across tissues to independent antibody HPA048123 (B). |
|
|
Immunohistochemical staining of human pancreas using Anti-PFDN6 antibody HPA043032. |
|
|
Immunohistochemical staining of human colon using Anti-PFDN6 antibody HPA043032. |
|
|
Immunohistochemical staining of human testis using Anti-PFDN6 antibody HPA043032. |
|
|
Immunohistochemical staining of human liver using Anti-PFDN6 antibody HPA043032. |
|
|
HPA043032-100ul |
|
|
HPA043032-100ul |
|
|
HPA043032-100ul |
Product Guarantee and Expert Support
