Anti-UPK2

Artikelnummer: ATA-HPA043312
Artikelname: Anti-UPK2
Artikelnummer: ATA-HPA043312
Hersteller Artikelnummer: HPA043312
Alternativnummer: ATA-HPA043312-100,ATA-HPA043312-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: MGC138598, UP2, UPII
uroplakin 2
Anti-UPK2
Klonalität: Polyclonal
Konzentration: 0.3 mg/ml
Isotyp: IgG
NCBI: 7379
UniProt: O00526
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: ISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKVVTSSFVVPPCRGRRELVS
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: UPK2
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:50 - 1:200
Immunohistochemistry analysis in human urinary bladder and liver tissues using HPA043312 antibody. Corresponding UPK2 RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebral cortex, endometrium, liver and urinary bladder using Anti-UPK2 antibody HPA043312 (A) shows similar protein distribution across tissues to independent antibody HPA061106 (B).
Immunohistochemical staining of human urinary bladder shows strong membranous positivity in urothelial cells.
Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.
Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected.
HPA043312-100ul
HPA043312-100ul
HPA043312-100ul