Anti-UPK2

Product Overview

• Article Name: Anti-UPK2
• Biozol Catalog Number: ATA-HPA043312
• Supplier Catalog Number: HPA043312
• Alternative Catalog Number: ATA-HPA043312-100,ATA-HPA043312-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: MGC138598, UP2, UPII

Product Description

uroplakin 2

Additional Information

Anti-UPK2

Product Properties

• Clonality: Polyclonal
• Concentration: 0.3 mg/ml
• Isotype: IgG
• NCBI: 7379
• UniProt: O00526
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: ISSLSGLLSPALTESLLVALPPCHLTGGNATLMVRRANDSKVVTSSFVVPPCRGRRELVS
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: UPK2
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:50 - 1:200

Images

Immunohistochemistry analysis in human urinary bladder and liver tissues using HPA043312 antibody. Corresponding UPK2 RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebral cortex, endometrium, liver and urinary bladder using Anti-UPK2 antibody HPA043312 (A) shows similar protein distribution across tissues to independent antibody HPA061106 (B).

Immunohistochemical staining of human urinary bladder shows strong membranous positivity in urothelial cells.

Immunohistochemical staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemical staining of human cerebral cortex shows no positivity in neurons as expected.

Immunohistochemical staining of human endometrium shows no positivity in glandular cells as expected.

HPA043312-100ul

HPA043312-100ul

HPA043312-100ul