Anti-CCSAP

Artikelnummer: ATA-HPA043443
Artikelname: Anti-CCSAP
Artikelnummer: ATA-HPA043443
Hersteller Artikelnummer: HPA043443
Alternativnummer: ATA-HPA043443-100,ATA-HPA043443-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: IHC
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: C1orf96, CSAP, FLJ41471
centriole, cilia and spindle-associated protein
Anti-CCSAP
Klonalität: Polyclonal
Konzentration: 0.2 mg/ml
Isotyp: IgG
NCBI: 126731
UniProt: Q6IQ19
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: EEQDAEAGDAEAEDAEDAALPALPVKDVEDKPEQQTRTRETDKSPTSTEPRQQPSALFARGNRKAVKSPQRSSSKIKENKHPFALYGW
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: CCSAP
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:500 - 1:1000
Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-CCSAP antibody. Corresponding CCSAP RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human cerebellum, cerebral cortex, kidney and pancreas using Anti-CCSAP antibody HPA043443 (A) shows similar protein distribution across tissues to independent antibody HPA028402 (B).
Immunohistochemical staining of human pancreas shows low expression as expected.
Immunohistochemical staining of human cerebral cortex shows high expression.
Immunohistochemical staining of human kidney using Anti-CCSAP antibody HPA043443.
Immunohistochemical staining of human cerebellum using Anti-CCSAP antibody HPA043443.
HPA043443-100ul
HPA043443-100ul
HPA043443-100ul