Anti-CCSAP

Product Overview

• Article Name: Anti-CCSAP
• Biozol Catalog Number: ATA-HPA043443
• Supplier Catalog Number: HPA043443
• Alternative Catalog Number: ATA-HPA043443-100,ATA-HPA043443-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: IHC
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: C1orf96, CSAP, FLJ41471

Product Description

centriole, cilia and spindle-associated protein

Additional Information

Anti-CCSAP

Product Properties

• Clonality: Polyclonal
• Concentration: 0.2 mg/ml
• Isotype: IgG
• NCBI: 126731
• UniProt: Q6IQ19
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: EEQDAEAGDAEAEDAEDAALPALPVKDVEDKPEQQTRTRETDKSPTSTEPRQQPSALFARGNRKAVKSPQRSSSKIKENKHPFALYGW
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: CCSAP
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:500 - 1:1000

Images

Immunohistochemistry analysis in human cerebral cortex and pancreas tissues using Anti-CCSAP antibody. Corresponding CCSAP RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human cerebellum, cerebral cortex, kidney and pancreas using Anti-CCSAP antibody HPA043443 (A) shows similar protein distribution across tissues to independent antibody HPA028402 (B).

Immunohistochemical staining of human pancreas shows low expression as expected.

Immunohistochemical staining of human cerebral cortex shows high expression.

Immunohistochemical staining of human kidney using Anti-CCSAP antibody HPA043443.

Immunohistochemical staining of human cerebellum using Anti-CCSAP antibody HPA043443.

HPA043443-100ul

HPA043443-100ul

HPA043443-100ul