Anti-C5orf49
Artikelnummer:
ATA-HPA043759
- Bilder (6)
| Artikelname: | Anti-C5orf49 |
| Artikelnummer: | ATA-HPA043759 |
| Hersteller Artikelnummer: | HPA043759 |
| Alternativnummer: | ATA-HPA043759-100,ATA-HPA043759-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Sonstiges |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LOC134121 |
| chromosome 5 open reading frame 49 |
| Anti-C5orf49 |
| Klonalität: | Polyclonal |
| Konzentration: | 0.6 mg/ml |
| Isotyp: | IgG |
| NCBI: | 134121 |
| UniProt: | A4QMS7 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | HRDDREHAKSLGLHVNEEEQERPVGVLTSSVYGKRINQPIEPLNRDFGRANHVQADFYRKNDIPSLKEPGFGHIAPS |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | C5orf49 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human fallopian tube and placenta tissues using Anti-C5orf49 antibody. Corresponding C5orf49 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human placenta shows low expression as expected. |
|
|
HPA043759-100ul |
|
|
HPA043759-100ul |
|
|
HPA043759-100ul |
Produktgarantie und fachkundiger Support
