Anti-C5orf49
Catalog Number:
ATA-HPA043759
- Images (6)
| Article Name: | Anti-C5orf49 |
| Biozol Catalog Number: | ATA-HPA043759 |
| Supplier Catalog Number: | HPA043759 |
| Alternative Catalog Number: | ATA-HPA043759-100,ATA-HPA043759-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Sonstiges |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | LOC134121 |
| chromosome 5 open reading frame 49 |
| Anti-C5orf49 |
| Clonality: | Polyclonal |
| Concentration: | 0.6 mg/ml |
| Isotype: | IgG |
| NCBI: | 134121 |
| UniProt: | A4QMS7 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | HRDDREHAKSLGLHVNEEEQERPVGVLTSSVYGKRINQPIEPLNRDFGRANHVQADFYRKNDIPSLKEPGFGHIAPS |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | C5orf49 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:2500 - 1:5000 |
|
|
Immunohistochemistry analysis in human fallopian tube and placenta tissues using Anti-C5orf49 antibody. Corresponding C5orf49 RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human fallopian tube shows high expression. |
|
|
Immunohistochemical staining of human placenta shows low expression as expected. |
|
|
HPA043759-100ul |
|
|
HPA043759-100ul |
|
|
HPA043759-100ul |
Product Guarantee and Expert Support
