Anti-FAM168B
Artikelnummer:
ATA-HPA043778
- Bilder (8)
| Artikelname: | Anti-FAM168B |
| Artikelnummer: | ATA-HPA043778 |
| Hersteller Artikelnummer: | HPA043778 |
| Alternativnummer: | ATA-HPA043778-100,ATA-HPA043778-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | KIAA0280L |
| family with sequence similarity 168, member B |
| Anti-FAM168B |
| Klonalität: | Polyclonal |
| Konzentration: | 0.2 mg/ml |
| Isotyp: | IgG |
| NCBI: | 130074 |
| UniProt: | A1KXE4 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSSSP |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | FAM168B |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human heart muscle, kidney, lymph node and skeletal muscle using Anti-FAM168B antibody HPA043778 (A) shows similar protein distribution across tissues to independent antibody HPA061659 (B). |
|
|
Immunohistochemical staining of human lymph node using Anti-FAM168B antibody HPA043778. |
|
|
Immunohistochemical staining of human heart muscle using Anti-FAM168B antibody HPA043778. |
|
|
Immunohistochemical staining of human skeletal muscle using Anti-FAM168B antibody HPA043778. |
|
|
Immunohistochemical staining of human kidney using Anti-FAM168B antibody HPA043778. |
|
|
HPA043778-100ul |
|
|
HPA043778-100ul |
|
|
HPA043778-100ul |
Produktgarantie und fachkundiger Support
