Anti-FAM168B
Catalog Number:
ATA-HPA043778
- Images (8)
| Article Name: | Anti-FAM168B |
| Biozol Catalog Number: | ATA-HPA043778 |
| Supplier Catalog Number: | HPA043778 |
| Alternative Catalog Number: | ATA-HPA043778-100,ATA-HPA043778-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | IHC |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | KIAA0280L |
| family with sequence similarity 168, member B |
| Anti-FAM168B |
| Clonality: | Polyclonal |
| Concentration: | 0.2 mg/ml |
| Isotype: | IgG |
| NCBI: | 130074 |
| UniProt: | A1KXE4 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSSSP |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | FAM168B |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | IHC: 1:50 - 1:200 |
|
|
Immunohistochemical staining of human heart muscle, kidney, lymph node and skeletal muscle using Anti-FAM168B antibody HPA043778 (A) shows similar protein distribution across tissues to independent antibody HPA061659 (B). |
|
|
Immunohistochemical staining of human lymph node using Anti-FAM168B antibody HPA043778. |
|
|
Immunohistochemical staining of human heart muscle using Anti-FAM168B antibody HPA043778. |
|
|
Immunohistochemical staining of human skeletal muscle using Anti-FAM168B antibody HPA043778. |
|
|
Immunohistochemical staining of human kidney using Anti-FAM168B antibody HPA043778. |
|
|
HPA043778-100ul |
|
|
HPA043778-100ul |
|
|
HPA043778-100ul |
Product Guarantee and Expert Support
