Anti-CD3E Antibody , Unconjugated, Rabbit, Polyclonal
Artikelnummer:
ATA-HPA043955
- Bilder (14)
| Artikelname: | Anti-CD3E Antibody , Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: | ATA-HPA043955 |
| Hersteller Artikelnummer: | HPA043955 |
| Alternativnummer: | ATA-HPA043955-100,ATA-HPA043955-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | IHC, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Pan-Cancer |
| CD3e molecule, epsilon (CD3-TCR complex) |
| Anti-CD3E |
| Klonalität: | Polyclonal |
| Konzentration: | 0.3 mg/ml |
| Isotyp: | IgG |
| NCBI: | 916 |
| UniProt: | P07766 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | WSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | CD3E |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | IHC: 1:500 - 1:1000, WB: 0.04-0.4 µg/ml |
|
|
Immunohistochemistry analysis in human lymph node and pancreas tissues using HPA043955 antibody. Corresponding CD3E RNA-seq data are presented for the same tissues. |
|
|
Immunohistochemical staining of human cerebral cortex, lymph node, spleen and tonsil using Anti-CD3E antibody HPA043955 (A) shows similar protein distribution across tissues to independent antibody HPA040957 (B). |
|
|
Immunohistochemical staining of human small intestine shows moderate to strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human granular layer of the cerebellum shows no cytoplasmic positivity as expected. |
|
|
Immunohistochemical staining of human spleen shows moderate to strong cytoplasmic positivity in cells in red pulp. |
|
|
Immunohistochemical staining of human pancreas shows no cytoplasmic positivity in exocrine glandular cells as expected. |
|
|
Immunohistochemical staining of human lymph node shows moderate to strong cytoplasmic positivity in lymphoid cells. |
|
|
Immunohistochemical staining of human cerebral cortex using Anti-CD3E antibody HPA043955. |
|
|
Immunohistochemical staining of human tonsil using Anti-CD3E antibody HPA043955. |
|
|
Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251 MG Lane 4: Human plasma Lane 5: Human Liver tissue Lane 6: Human Tonsil tissue |
|
|
HPA043955 |
|
|
|
|
|
HPA043955 |
|
|
HPA043955 |
Produktgarantie und fachkundiger Support
