Anti-PRAME

Artikelnummer: ATA-HPA045153
Artikelname: Anti-PRAME
Artikelnummer: ATA-HPA045153
Hersteller Artikelnummer: HPA045153
Alternativnummer: ATA-HPA045153-100,ATA-HPA045153-25
Hersteller: Atlas Antibodies
Wirt: Rabbit
Kategorie: Antikörper
Applikation: WB
Spezies Reaktivität: Human
Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Konjugation: Unconjugated
Alternative Synonym: CT130, MAPE
preferentially expressed antigen in melanoma
Anti-PRAME
Klonalität: Polyclonal
Isotyp: IgG
NCBI: 23532
UniProt: P78395
Puffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Reinheit: Affinity purified using the PrEST antigen as affinity ligand
Sequenz: LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI
Lagerung: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Target-Kategorie: PRAME
Antibody Type: Monoclonal Antibody
Application Verdünnung: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml
Immunohistochemistry analysis in human testis and prostate tissues using HPA045153 antibody. Corresponding PRAME RNA-seq data are presented for the same tissues.
Immunohistochemical staining of human testis shows weak to moderate nuclear positivity in cells in seminiferous ducts.
Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected.
Western blot analysis in human cell lines U2OS and SK-MEL-30 using Anti-PRAME antibody. Corresponding PRAME RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.
Western blot analysis in control (vector only transfected HEK293T lysate) and PRAME over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401847).
HPA045153-100ul