Anti-PRAME

Product Overview

• Article Name: Anti-PRAME
• Biozol Catalog Number: ATA-HPA045153
• Supplier Catalog Number: HPA045153
• Alternative Catalog Number: ATA-HPA045153-100,ATA-HPA045153-25
• Manufacturer: Atlas Antibodies
• Host: Rabbit
• Category: Antikörper
• Application: WB
• Species Reactivity: Human
• Immunogen: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
• Conjugation: Unconjugated
• Alternative Names: CT130, MAPE

Product Description

preferentially expressed antigen in melanoma

Additional Information

Anti-PRAME

Product Properties

• Clonality: Polyclonal
• Isotype: IgG
• NCBI: 23532
• UniProt: P78395
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
• Purity: Affinity purified using the PrEST antigen as affinity ligand
• Sequence: LLLSHIHASSYISPEKEEQYIAQFTSQFLSLQCLQALYVDSLFFLRGRLDQLLRHVMNPLETLSITNCRLSEGDVMHLSQSPSVSQLSVLSLSGVMLTDVSPEPLQALLERASATLQDLVFDECGI
• Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
• Target: PRAME
• Antibody Type: Monoclonal Antibody

Application Notes

• Application Dilute: IHC: 1:200 - 1:500, WB: 0.04-0.4 µg/ml

Images

Immunohistochemistry analysis in human testis and prostate tissues using HPA045153 antibody. Corresponding PRAME RNA-seq data are presented for the same tissues.

Immunohistochemical staining of human testis shows weak to moderate nuclear positivity in cells in seminiferous ducts.

Immunohistochemical staining of human prostate shows no positivity in glandular cells as expected.

Western blot analysis in human cell lines U2OS and SK-MEL-30 using Anti-PRAME antibody. Corresponding PRAME RNA-seq data are presented for the same cell lines. Loading control: Anti-COX4I1.

Western blot analysis in control (vector only transfected HEK293T lysate) and PRAME over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY401847).

HPA045153-100ul