Anti-BICC1
Artikelnummer:
ATA-HPA045212
- Bilder (7)
| Artikelname: | Anti-BICC1 |
| Artikelnummer: | ATA-HPA045212 |
| Hersteller Artikelnummer: | HPA045212 |
| Alternativnummer: | ATA-HPA045212-100,ATA-HPA045212-25 |
| Hersteller: | Atlas Antibodies |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Konjugation: | Unconjugated |
| Alternative Synonym: | BICC1 |
| BicC family RNA binding protein 1 |
| Anti-BICC1 |
| Klonalität: | Polyclonal |
| Isotyp: | IgG |
| NCBI: | 80114 |
| UniProt: | Q9H694 |
| Puffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Reinheit: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequenz: | NAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRA |
| Lagerung: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target-Kategorie: | BICC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Verdünnung: | WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human placenta shows moderate granular cytoplasmic positivity. |
|
|
Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells. |
|
|
Western blot analysis in human cell lines Caco-2 and A-431 using Anti-BICC1 antibody. Corresponding BICC1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB. |
|
|
HPA045212-100ul |
Produktgarantie und fachkundiger Support
