Anti-BICC1
Catalog Number:
ATA-HPA045212
- Images (7)
| Article Name: | Anti-BICC1 |
| Biozol Catalog Number: | ATA-HPA045212 |
| Supplier Catalog Number: | HPA045212 |
| Alternative Catalog Number: | ATA-HPA045212-100,ATA-HPA045212-25 |
| Manufacturer: | Atlas Antibodies |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Conjugation: | Unconjugated |
| Alternative Names: | BICC1 |
| BicC family RNA binding protein 1 |
| Anti-BICC1 |
| Clonality: | Polyclonal |
| Isotype: | IgG |
| NCBI: | 80114 |
| UniProt: | Q9H694 |
| Buffer: | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Purity: | Affinity purified using the PrEST antigen as affinity ligand |
| Sequence: | NAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRA |
| Storage: | Store at +4°C for short term storage. Long time storage is recommended at -20°C. |
| Target: | BICC1 |
| Antibody Type: | Monoclonal Antibody |
| Application Dilute: | WB: 0.04-0.4 µg/ml |
|
|
Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm. |
|
|
Immunohistochemical staining of human placenta shows moderate granular cytoplasmic positivity. |
|
|
Immunohistochemical staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules. |
|
|
Immunohistochemical staining of human small intestine shows moderate granular cytoplasmic positivity in glandular cells. |
|
|
Immunohistochemical staining of human pancreas shows moderate granular cytoplasmic positivity in exocrine glandular cells. |
|
|
Western blot analysis in human cell lines Caco-2 and A-431 using Anti-BICC1 antibody. Corresponding BICC1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB. |
|
|
HPA045212-100ul |
Product Guarantee and Expert Support
